Canadian Crafted - Lab Tested
KLW
KLOW Blend
80mg/vial
KLOW Blend
Lyophilized · sealed · handled for fulfillment
HPLC purity
Certificate
Janoshik #84487
Tested by
Janoshik
/ Peptide Blends

KLOW Blend

GHK-Cu + BPC-157 + TB-500 + KPV blend · 80mg per vial

CA$150.00per 80mg vialIn stock
CompoundKLOW Blend
FamilyPeptide Blends
CAS89030-95-5 / 137525-51-0 / 77591-33-4 / 67727-97-3
Molecular formulaC14H24CuN6O4 / C62H98N16O22 / C212H350N56O78S / C17H23N5O4S
Molecular weight419.9 / 1419.5 / 4963.5 / 393.5 Da
Residues3 / 15 / 43 / 3 amino acids
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)Blend
CertificateJanoshik #84487
COA RecordsResearch-use onlyShips from British ColumbiaInterac e-Transfer
Browse COA Archive
In stock
Size / Pack
1
○ Ships from Vancouver · tracked dispatch · COA Records
KLOW Blend
CA$150.00

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

3 / 15 / 43 / 3-residue peptide. Peptide Blends class.

○ Amino-acid sequence · 3-letter code
GHK·Cu: Gly·His·Lys·Cu; BPC·157: GEPPPGKPADDAGLV; TB·500: Ac·SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES; KPV: Lys·Pro·Val
Residues
3 / 15 / 43 / 3
Mol. weight
419.9 / 1419.5 / 4963.5 / 393.5 Da
Formula
C14H24CuN6O4 / C62H98N16O22 / C212H350N56O78S / C17H23N5O4S
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Certificate of Analysis · Certificate Janoshik #84487

Every lot, independently
HPLC-tested and signed.

This product's certificate is matched to the exact lot you'll receive. HPLC chromatogram, mass-spec confirmation, residual solvent, endotoxin — all on one page, scannable via the QR.

Certificate of AnalysisCertificate Janoshik #84487
CompoundKLOW BlendPurity (HPLC)Mass (MS)419.9 / 1419.5 / 4963.5 / 393.5 Da ✓
Residual solventEndotoxin
/ Recently viewed

Compounds you've looked at

Browse catalog →