Tools & pages
Peptide calculator/peptide-calculator
COA archive/coas
Track order/order/lookup
Research writing/research
FAQ/faq
Shop all/store
↑↓ navigate · ↵ open · esc close
Canadian Crafted - Lab Tested
CJC-IPA
CJC-1295 + Ipamorelin
10mg/vial
CJC-1295 + Ipamorelin — image 1
Lyophilized · sealed · handled for fulfillment
HPLC purity
Lot
VTL-0421
Tested by
/ Peptide Blends

CJC-1295 + Ipamorelin

CJC-1295 (no DAC) + Ipamorelin blend · 10mg per vial

CA$80.00Product.pricePerIn stock
CompoundCJC-1295 + Ipamorelin
FamilyPeptide Blends
CAS863288-34-0 / 170851-70-4
Molecular formulaC165H269N47O46 / C38H49N9O5
Molecular weight3647.2 / 711.8 Da
Residues30 / 5 amino acids
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)BLEND
Current lotVTL-0421
COA recordsResearch-use onlyShips from VancouverInterac e-Transfer
In stock
Size / Pack
Single Vial
10 Vial Kit
1
○ Ships from Vancouver · tracked dispatch · COA Records

Reship or refund guarantee Guarantee terms

CJC-1295 + Ipamorelin
CA$80.00

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

30 / 5-residue peptide. Peptide Blends class.

○ Amino-acid sequence · 3-letter code
CJC·1295: DAibYADAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL; Ipamorelin: Aib·His·D·2Nal·D·Phe·Lys·NH2
Residues
30 / 5
Mol. weight
3647.2 / 711.8 Da
Formula
C165H269N47O46 / C38H49N9O5
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Quick Facts

  • Vitatide's CJC-1295 + Ipamorelin is supplied as a white lyophilized powder.
  • CJC-1295 + Ipamorelin's molecular formula is C165H269N47O46 / C38H49N9O5, with a molecular mass of 3647.2 / 711.8 Da.
  • CJC-1295 + Ipamorelin is a 30 / 5-residue peptide.
  • Vitatide recommends storing unreconstituted CJC-1295 + Ipamorelin at 2–8°C (unmixed).
  • For in-vitro laboratory research only — not for human use.
/ Recently viewed

Compounds you've looked at

Browse catalog