Tools & pages
Peptide calculator/peptide-calculator
COA archive/coas
Track order/order/lookup
Research writing/research
FAQ/faq
Shop all/store
↑↓ navigate · ↵ open · esc close
Canadian Crafted - Lab Tested
GLW
GLOW Blend
70mg/vial
GLOW Blend — image 1
○ Lyophilized · sealed · handled for fulfillment
HPLC purity
—
Lot
VTL-0421
Tested by
—
/ Peptide Blends

GLOW Blend

GHK-Cu + BPC-157 + TB-500 blend · 70mg per vial

CA$135.00per 70mg vial● In stock
CompoundGLOW Blend
FamilyPeptide Blends
CAS89030-95-5 / 137525-51-0 / 77591-33-4
Molecular formulaC14H24CuN6O4 / C62H98N16O22 / C212H350N56O78S
Molecular weight419.9 / 1419.5 / 4963.5 Da
Residues3 / 15 / 43 amino acids
AppearanceDeep blue lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)BLEND
Current lotVTL-0421
COA recordsResearch-use onlyShips from VancouverInterac e-Transfer
In stock
Size / Pack
Single Vial
10 Vial Kit
1
○ Ships from Vancouver · tracked dispatch · COA Records

Reship or refund guarantee Guarantee terms

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

3 / 15 / 43-residue peptide. Peptide Blends class.

○ Amino-acid sequence · 3-letter code
GHK·Cu: Gly·His·Lys·Cu; BPC·157: GEPPPGKPADDAGLV; TB·500: Ac·SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Residues
3 / 15 / 43
Mol. weight
419.9 / 1419.5 / 4963.5 Da
Formula
C14H24CuN6O4 / C62H98N16O22 / C212H350N56O78S
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

○ As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

○ Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Quick Facts

  • Vitatide's GLOW Blend is supplied as a deep blue lyophilized powder.
  • GLOW Blend's molecular formula is C14H24CuN6O4 / C62H98N16O22 / C212H350N56O78S, with a molecular mass of 419.9 / 1419.5 / 4963.5 Da.
  • GLOW Blend is a 3 / 15 / 43-residue peptide.
  • Vitatide recommends storing unreconstituted GLOW Blend at 2–8°C (unmixed).
  • For in-vitro laboratory research only — not for human use.
/ Recently viewed

Compounds you've looked at

Browse catalog →