Tools & pages
Peptide calculator/peptide-calculator
COA archive/coas
Track order/order/lookup
Research writing/research
FAQ/faq
Shop all/store
↑↓ navigate · ↵ open · esc close
Canadian Crafted - Lab Tested
SRM
Sermorelin
5mg/vial
Sermorelin — image 1
Lyophilized · sealed · handled for fulfillment
HPLC purity
99.4%
Lot
52251
Tested by
Finnrick
COA
/ Single Peptides

Sermorelin

GHRH(1–29) analog · 5mg per vial

CA$65.00per 5mg vialOut of stock
CompoundSermorelin
FamilySingle Peptides
CAS86168-78-7
Molecular formulaC149H246N44O42S
Molecular weight3358 Da
Residues29 amino acids
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)99.4%
Current lot52251
COA RecordsResearch-use onlyShips from British ColumbiaInterac e-Transfer
Out of stock
Size / Pack
Single Vial
10 Vial Kit
1
○ Ships from Vancouver · tracked dispatch · COA Records

Reship or refund guarantee Guarantee terms

Sermorelin
CA$65.00

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

Certificate of Analysis · Lot 52251

Every lot, independently
HPLC-tested and signed.

This product's certificate is matched to the exact lot you'll receive. HPLC chromatogram, mass-spec confirmation, residual solvent, endotoxin — all on one page, scannable via the QR.

Certificate of AnalysisLot 52251
CompoundSermorelinPurity (HPLC)99.4%Mass (MS)3358 Da ✓
Residual solvent< 0.01%Endotoxin< 0.25 EU/mg
/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

29-residue peptide. Single Peptides class.

○ Amino-acid sequence · 3-letter code
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL·NH2
Residues
29
Mol. weight
3358 Da
Formula
C149H246N44O42S
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Quick Facts

  • Vitatide's Sermorelin is supplied as a white lyophilized powder.
  • Sermorelin's molecular formula is C149H246N44O42S, with a molecular mass of 3358 Da.
  • Sermorelin is a 29-residue peptide.
  • Independent HPLC testing measured 99.4% purity for this lot of Sermorelin.
  • Lot 52251 of Vitatide's Sermorelin was tested by Finnrick; the certificate of analysis is published in the COA library.
  • Residual solvent for this lot is reported at < 0.01%, with endotoxin at < 0.25 EU/mg.
  • Vitatide recommends storing unreconstituted Sermorelin at 2–8°C (unmixed).
  • For in-vitro laboratory research only — not for human use.
/ Recently viewed

Compounds you've looked at

Browse catalog →