Tools & pages
Peptide calculator/peptide-calculator
COA archive/coas
Track order/order/lookup
Research writing/research
FAQ/faq
Shop all/store
↑↓ navigate · ↵ open · esc close
Canadian Crafted - Lab Tested
Cart 0
TB5
TB-500
10mg/vial
TB-500 — image 1
○ Lyophilized · sealed · handled for fulfillment
HPLC purity
99.33%
Certificate
Janoshik #100580
Tested by
Janoshik
COA
/ Single Peptides

TB-500

Synthetic thymosin β4 fragment · 10mg per vial

CA$80.00per 10mg vial● In stock
CompoundTB-500
FamilySingle Peptides
CAS77591-33-4
Molecular formulaC212H350N56O78S
Molecular weight4963.5 Da
Residues43 amino acids
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)99.33%
CertificateJanoshik #100580
COA RecordsResearch-use onlyShips from British ColumbiaInterac e-Transfer
Browse COA ArchiveReconstitution Calculator
In stock
Size / Pack
Single Vial
10 Vial Kit
1
○ Ships from Vancouver · tracked dispatch · COA Records
TB-500—
CA$80.00

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

Certificate of Analysis · Certificate Janoshik #100580

Every lot, independently
HPLC-tested and signed.

This product's certificate is matched to the exact lot you'll receive. HPLC chromatogram, mass-spec confirmation, residual solvent, endotoxin — all on one page, scannable via the QR.

View full COA →Download PDF
Certificate of AnalysisCertificate Janoshik #100580
CompoundTB-500Purity (HPLC)99.33%Mass (MS)4963.5 Da ✓
Residual solvent< 0.01%Endotoxin< 0.25 EU/mg
/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

43-residue peptide. Single Peptides class.

○ Amino-acid sequence · 3-letter code
Ac·SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Residues
43
Mol. weight
4963.5 Da
Formula
C212H350N56O78S
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

○ As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

○ Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Quick Facts

  • Vitatide's TB-500 is supplied as a white lyophilized powder.
  • TB-500's molecular formula is C212H350N56O78S, with a molecular mass of 4963.5 Da.
  • TB-500 is a 43-residue peptide.
  • Independent HPLC testing measured 99.33% purity for this lot of TB-500.
  • Certificate Janoshik #100580 of Vitatide's TB-500 was tested by Janoshik; the certificate of analysis is published in the COA library.
  • Residual solvent for this lot is reported at < 0.01%, with endotoxin at < 0.25 EU/mg.
  • Vitatide recommends storing unreconstituted TB-500 at 2–8°C (unmixed).
  • For in-vitro laboratory research only — not for human use.
/ Related compounds

Compounds researchers pair with TB-500

From the research library

/ Recently viewed

Compounds you've looked at

Browse catalog →