Tools & pages
Peptide calculator/peptide-calculator
COA archive/coas
Track order/order/lookup
Research writing/research
FAQ/faq
Shop all/store
↑↓ navigate · ↵ open · esc close
Canadian Crafted - Lab Tested
BPC-TB
BPC-157 + TB-500
10mg/vial
BPC-157 + TB-500 — image 1
Lyophilized · sealed · handled for fulfillment
HPLC purity
Lot
VTL-0421
Tested by
/ Peptide Blends

BPC-157 + TB-500

BPC-157 + TB-500 blend (1:1) · 10mg per vial

CA$65.00per 10mg vialIn stock
CompoundBPC-157 + TB-500
FamilyPeptide Blends
CAS137525-51-0 / 77591-33-4
Molecular formulaC62H98N16O22 / C212H350N56O78S
Molecular weight1419.5 / 4963.5 Da
Residues15 / 43 amino acids
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water (preferred) · acetate buffer 0.05 M
Purity (HPLC)Blend
Current lotVTL-0421
COA RecordsResearch-use onlyShips from British ColumbiaInterac e-Transfer
In stock
Size / Pack
Single Vial
10 Vial Kit
1
○ Ships from Vancouver · tracked dispatch · COA Records
BPC-157 + TB-500
CA$65.00

For in-vitro research only. This compound is sold strictly for laboratory study. Not for human or veterinary use. Not a drug, supplement, food, or cosmetic. Acceptance of the Research-Use-Only Acknowledgement is required at checkout.

/ Documentation · boundaries

Handling is set by your laboratory SOP

Vitatide does not provide reconstitution, dosing, administration, or route-of-use protocols. Use posted lot documents where available and your laboratory's validated procedures.

Product pages may show lot-specific COA fields where source documents are posted. Preparation, storage after receipt, and downstream assay handling remain the responsibility of the receiving laboratory.
/ Structure · sequence

Primary structure

15 / 43-residue peptide. Peptide Blends class.

○ Amino-acid sequence · 3-letter code
BPC·157: GEPPPGKPADDAGLV; TB·500: Ac·SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Residues
15 / 43
Mol. weight
1419.5 / 4963.5 Da
Formula
C62H98N16O22 / C212H350N56O78S
/ Stability · storage

Handling & storage

Storage conditions should be read from lot-specific COA/source documents where available, then handled under your laboratory's validated SOP.

As shipped
2–8°C (unmixed)Lot document / lab SOP

Use the lot-specific COA or source document where available; otherwise follow your laboratory's validated storage SOP.

Post-receipt handling
Lab SOPNo storefront protocol

Vitatide does not provide preparation, administration, or use-window protocols; post-receipt handling is set by the end laboratory.

● Avoid
Repeat freeze/thaw cycles · direct sunlight · centrifugation of unreconstituted vials · vortexing the solution.

Quick Facts

  • Vitatide's BPC-157 + TB-500 is supplied as a white lyophilized powder.
  • BPC-157 + TB-500's molecular formula is C62H98N16O22 / C212H350N56O78S, with a molecular mass of 1419.5 / 4963.5 Da.
  • BPC-157 + TB-500 is a 15 / 43-residue peptide.
  • Vitatide recommends storing unreconstituted BPC-157 + TB-500 at 2–8°C (unmixed).
  • For in-vitro laboratory research only — not for human use.
/ Recently viewed

Compounds you've looked at

Browse catalog →